Recombinant Human Haptoglobin-Zonulin

Product Category: DAPCEL™ Proteins

Human Haptoglobin/Zonulin, 50 µg $550.00 Add to cart
Human Haptoglobulin/Zonulin, 1 mg $5,100.00 Add to cart
Human Haptoglobulin/Zonulin, 5 mg $18,960.00 Add to cart

Catalog Numbers:  6001-50 (50 µg), 6001-1000 (1 mg), 6001-5000 (5 mg)

Name : Recombinant Human Haptoglobin/Zonulin
Species : Human
Source : HEK 293 cells
Amino acids :   19 to 406 (Arg-161 muated to Gly-161)
Predicted Molecular Weight :   43.2 kDa
ProteinID : HPT_HUMAN

Sequence:
VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTL
NDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLR
TEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQGILGGHLD
AKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIA
PTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLP
SKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTV
PEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDT
WYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN*

*Recombinant proteins are expressed from synthetic genes. DAPCEL Inc. synthetic gene design technology provides highest protein quality in terms of protein folding and bioactivity.

Product Datasheet (PDF)

MSDS (PDF)

Product specification
Estimated Molecular Weight, SDS-PAGE: 55 kDa, under reducing conditions
Grade & Purity: >95%, (according to SDS-PAGE stained with SimplyBlue SafeStain, (Invitrogen)).
Endotoxins: Less than 0.1 EU per 1 µg of the protein by LAL method.
Formulation: Lyophilized from 0.2 µm filtered solution of PBS, pH 7.4.


Shipping

Product is shipped at ambient temperature. Upon receipt, store at temperatures recommended below.

Product application and Storage

Reconstitution: Spin before opening. For optimal recovery - reconstitute in sterile water at ~0.1 mg/mL at room temperature; after adding water, re-cap the vial and tap gently, ensure to cover all the surfaces inside the vial. Do not mix by vortexing or by extensive pipetting. Let the vial to sit at room temperature with gentle agitation for at least 10-15 min before aliquoting or using.

Storage: To avoid loss of the protein, store the reconstituted protein in aliquots (no smaller than 10 µL) in polypropylene or siliconized tubes. Store dried and reconstituted protein at -20 and/or -80°C. Avoid repeated freeze-thaw cycles.

Stability

12 months from date of receipt, stored at ­20 to ­80 °C as supplied.

6 months, ­20 to ­70 °C under sterile conditions after reconstitution in water.

1 month, 2 to 8 °C under sterile conditions after reconstitution in water.

Application Note: For research purposes only. Not for use in humans.